MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV Note: The complete sequence may
include tag sequence, target protein sequence, linker sequence
and extra sequence that is translated with the protein sequence
for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant
protein is critical to your application, please explicitly
request the full and complete sequence of this protein before
ordering.
蛋白標簽:
C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it's possible to develop.
產品提供形式:
Lyophilized powder Note: We will
preferentially ship the format that we have in stock, however,
if you have any special requirement for the format, please
remark your requirement when placing the order, we will prepare
according to your demand.
緩沖液:
Lyophilized from PBS, 6% Trehalose, pH 7.4.
復溶:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃.
Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
儲存條件:
Store at -20°C/-80°C upon receipt, aliquoting is
necessary for
mutiple use. Avoid repeated freeze-thaw cycles.
保質期:
The shelf life is related to many factors, storage
state,
buffer ingredients, storage temperature and the stability of the
protein
itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C.
The
shelf life of lyophilized form is 12 months at -20°C/-80°C.
貨期:
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
注意事項:
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
observations implicate TASK-3 as a critical factor in cell cycle progression and corroborate its potential as a therapeutic target in breast cancer treatment. PMID: 29596383
point mutations in DLK1 and KCNK9 at least do not seem to be a common cause of central precocious puberty in girls. PMID: 28672280
In conclusion, we have identified the first selective activator of the two-pore domain potassium channel TASK3. PMID: 28882594
KCNK9 imprinting syndrome is a rare cause of intellectual disability, congenital hypotonia, palatal abnormalities, and occasional seizures. PMID: 27151206
Our results provide evidence for new loci influencing abdominal visceral (BBS9, ADCY8, KCNK9) and subcutaneous (MLLT10/DNAJC1/EBLN1) fat, and confirmed a locus (THNSL2) previously reported to be associated with abdominal fat in women. PMID: 26480920
TASK-1 and TASK-3 may form heterodimers in human atrial cardiomyocytes. PMID: 25655935
During conductance simulation experiments, both TASK-3 and TREK-1 channels were able to repolarise the membrane once AP threshold was reached PMID: 25482670
The findings of this study suggest that variations in KCNK9 genes are associated with both mild and severe persistent breast pain after breast cancer surgery. PMID: 25599232
Diacylglycerol mediates regulation of TASK1 and TASK3 potassium channels by GNAQ. PMID: 25420509
Interference with TASK-3 channel expression, therefore, induces caspase-dependent and -independent apoptosis of melanoma cells, most likely via causing mitochondrial depolarization. PMID: 25318378
K2P3.1 and K2P9.1 undergo rapid dynamin-dependent endocytosis PMID: 23807092
Mutations of KCNK9 or epigenetic disturbances within the PEG13 imprinted cluster do not significantly contribute to the cause of the developmental disabilities tested in this study. PMID: 24980697
Two SNPs replicated: the paternal rs2471083-C allele (located near the imprinted KCNK9 gene) and the paternal rs3091869-T allele (located near the SLC2A10 gene) increased BMI equally (beta = 0.11 (SD), P<0.0027) PMID: 25078964
For KCNK9, two SNPs (i.e., rs3780039, rs11166921) were associated with the occurrence of preoperative breast pain. PMID: 24392765
We observed co-localization of the TASK-3 protein and a mitochondrial marker in the mitochondria of HaCaT cells. PMID: 24126847
By both a gain-of-function additional mutation of TASK3 channels. PMID: 24342771
TNFalpha activation and TASK3 channel activity can promote cellular apoptosis. PMID: 24307172
Overexpression of TASK-3 expression is associated with ovarian cancer. PMID: 23564779
Results of an exploratory study suggest that blood pressure and aldosterone production may be affected by variations in KCNK9. The findings could have relevance to risk for hypertension. PMID: 22893713
an increase in TASK-3 expression levels reduces cell migration/invasion in breast cancer cells PMID: 21910834
Depletion of the endogenous phosphatidylinositol-4,5-bisphosphate pool in living cells consistently finds no change in currents mediated by TASK-1 and TASK-3. PMID: 21540350
TASK-3 immunoreactivity was detected in both astrocytes and microglia of temporal lobe epilepsy patients. PMID: 21710317
TASK-3 channels are functionally present in the mitochondria of the melanoma cells, and their function is essential for the survival of these cells. PMID: 21512417
cAMP-dependent protein kinase is responsible for the phosphorylation of the terminal serine in both K(2P)3.1 and K(2P)9.1 PMID: 21357689
Western analysis confirms expression of TASK1 and TASK3 in medulloblastoma cells. PMID: 20931182
KCNK9 gene is imprinted in human and mouse, exhibiting preferential expression from the maternal allele in brain. PMID: 17704508
TASK-1 and 3 are determinant of aldosterone secretion and adrenocortical zonation. PMID: 20049674
TASK-3 responds to voltage in a way that reveals gating at its inner, cytoplasmic mouth through movements of membrane helices M2 and M4. PMID: 19703964
TASK-1 and TASK-3 differed insofar as a large portion of the C terminus was necessary for the full effects of halothane and TRH on TASK-3 but not on TASK-1 PMID: 11886861
Overexpression of KCNK9 in cell lines promotes tumor formation and confers resistance to both hypoxia and serum deprivation. PMID: 12676587
results establish a direct link between the potassium channel activity of TASK3 and its oncogenic functions and imply that blockers for this potassium channel may have therapeutic potential for the treatment of cancers PMID: 12782791
TASK3 is expressed in pia mater, astrocytes, Purkinje and granule cells PMID: 15197476
TASK-3 channels underlie a major component of cerebellar granule neurons leak current which is sensitive to block by zinc PMID: 15284350
Overexpression rather than mutation of the KCNK9 gene may contribute to the development of colorectal cancers. PMID: 15601307
The expression pattern of TASK-3 in Melanoma cells is determined. PMID: 17013562
(Glutamic acid-aspartic acid-glutamic acid) in human TASK-3 is a major determinant of the rate of endoplasmic reticulum export and is required for efficient surface expression of the channel. PMID: 17547699
TASK-3 channels are present in the mitochondria in both malignantly transformed and healthy cells, suggesting that they might have roles in ensuring mitochondrial functions. PMID: 18094996
TASK3 channels may possibly represent a novel molecular target for the treatment of human glioblastoma PMID: 18217213
K(2)P channels as novel potassium conductance on T lymphocytes critically influencing T cell effector function and identify a possible molecular target for immunomodulation in T cell-mediated autoimmune disorders PMID: 18375952
the TASK3 M1P1 loop lies close to the pore, regulating TASK3 channel activity PMID: 18417474
a mutation in the genomically imprinted potassium channel KCNK9 may have a role in the maternally inherited Birk Barel mental retardation dysmorphism syndrome PMID: 18678320
Thus, regulated expression of TASK channels might contribute to a molecular switch between death and survival of neurons in autoimmune CNS inflammation. PMID: 18824070
Both TASK-3 and TREK-1 are functionally operational in the adrenocortical H295R cell line, modulate membrane potential and aldosterone secretion. PMID: 18854423