ADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL Note: The complete sequence may
include tag sequence, target protein sequence, linker sequence
and extra sequence that is translated with the protein sequence
for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant
protein is critical to your application, please explicitly
request the full and complete sequence of this protein before
ordering.
蛋白標(biāo)簽:
N-terminal 10xHis-tagged and C-terminal Myc-tagged
產(chǎn)品提供形式:
Liquid or Lyophilized powder Note: We will
preferentially ship the format that we have in stock, however,
if you have any special requirement for the format, please
remark your requirement when placing the order, we will prepare
according to your demand.
緩沖液:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
復(fù)溶:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
儲(chǔ)存條件:
Store at -20°C/-80°C upon receipt, aliquoting is
necessary for
mutiple use. Avoid repeated freeze-thaw cycles.
保質(zhì)期:
The shelf life is related to many factors, storage
state,
buffer ingredients, storage temperature and the stability of the
protein
itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C.
The
shelf life of lyophilized form is 12 months at -20°C/-80°C.
貨期:
3-7 business days
注意事項(xiàng):
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Dual cyclooxygenase and peroxidase in the biosynthesis pathway of prostanoids, a class of C20 oxylipins mainly derived from arachidonate, with a particular role in the inflammatory response. The cyclooxygenase activity oxygenates arachidonate (AA, C20:4(n-6)) to the hydroperoxy endoperoxide prostaglandin G2 (PGG2), and the peroxidase activity reduces PGG2 to the hydroxy endoperoxide PGH2, the precursor of all 2-series prostaglandins and thromboxanes. This complex transformation is initiated by abstraction of hydrogen at carbon 13 (with S-stereochemistry), followed by insertion of molecular O2 to form the endoperoxide bridge between carbon 9 and 11 that defines prostaglandins. The insertion of a second molecule of O2 (bis-oxygenase activity) yields a hydroperoxy group in PGG2 that is then reduced to PGH2 by two electrons. Involved in the constitutive production of prostanoids in particular in the stomach and platelets. In gastric epithelial cells, it is a key step in the generation of prostaglandins, such as prostaglandin E2 (PGE2), which plays an important role in cytoprotection. In platelets, it is involved in the generation of thromboxane A2 (TXA2), which promotes platelet activation and aggregation, vasoconstriction and proliferation of vascular smooth muscle cells.
Prostaglandin D2 generation from human lung mast cells is catalysed exclusively by cyclooxygenase-1 PMID: 29225187
Extracellular histones disarrange vasoactive mediators release through a COX1-COX2-eNOS interaction in human endothelial cells. PMID: 28244682
Results suggested that in Chinese Han patients with stroke taking aspirin for secondary prevention, PTGS1 polymorphisms may increase the risk of poor functional outcomes and this effect may be modulated by the smoking status. PTGS1 gene-smoking interaction might in part reflect the heterogeneity in the prognosis of patients treated with aspirin. PMID: 28431615
analysis of co-existing variants in both F8 and PTGS-1 genes in a three-generation pedigree of hemophilia A; the PTGS-1 variant was associated with specific functional defects in the arachidonic acid pathway and more severe hemorrhage. PMID: 27629384
Data suggest expression of PTGS1 in colon is significantly correlated with expression of PTGS2, PTGES1, PTGER2, and PTGER4; this study was conducted in individuals at high risk for colon cancer treated with Mediterranean diet versus a Healthy Eating diet for prevention of colon cancer. (PG = prostaglandin; PTGS2 = PG-endoperoxide synthase 2; PTGES1 = PGE synthase protein; PTGER2 = PGE receptor 2; PTGER4 = PGE receptor 4) PMID: 27548026
Epithelial Cells Induce a Cyclo-Oxygenase-1-Dependent Endogenous Reduction in Airway Smooth Muscle Contractile Phenotype PMID: 28708434
Dimethyl ester of bilirubin exhibits anti-inflammatory activity through inhibition of secretory phospholipase A2, lipoxygenase and cyclooxygenase. PMID: 27060751
Panax quinquefolium saponin attenuated HUVEC apoptosis and improved the dual antiplatelet-mediated reduction of platelet adhesion to injured HUVECs and the underlying mechanisms may be associated with PI3K/AKT and COX pathways. PMID: 27401285
The interactions of COX-1of rs3842787 and cox-2 of rs20417 were associated with aspirin resistance of stroke. PMID: 27318652
Results show a trend toward an association between rs1236913 SNP and worst pain scores on nonsurgical root canal therapy post-treatment day 1 PMID: 26081267
We provide the first report that pro-angiogenic genes PECAM1, PTGS1, FGD5, and MCAM may play a vital role in pathological dermal angiogenesis disorders of psoriasis. PMID: 26748901
a new neutrophil-activating platelet-derived lipid generated by COX-1 is presented that can activate or prime human neutrophils, suggesting a role in innate immunity and acute inflammation. PMID: 27129261
Seminal COX-1 is over-expressed in infertile oligoasthenoteratozoospermic (OAT) men with varicocele (Vx) compared with fertile men with/without and infertile OAT men without Vx being associated with oxidative stress, Vx grade and Vx laterality. PMID: 25906828
variable turnover rate represents the most convincing determinant of the inter-individual variability in response to aspirin for primary prevention in diabetes mellitus PMID: 26245672
In Indian peptic ulcer hemorrhage patients, those with Cox-1 A842G polymorphisms tended to have less gastric ulcers among those with the A842G/C50T polymorphism. PMID: 27522738
single nucleotide polymorphisms show a protective effect under a dominant model of diisocyanate-induced asthma PMID: 25721048
inverse allosteric regulation likely underlies the ability of PGHS-2 to operate at low AA concentrations, when PGHS-1 is effectively latent. PMID: 26703471
PON1, P2Y12 and COX1 polymorphisms were associated with poorer vascular outcomes in patients with extracranial or intracranial stents. PMID: 26870959
The regulation of important oxylipin metabolic genes in peripheral blood mononuclear cells varied with the extent of change in arachidonic acid concentrations in the case of PTGS1 and ALOX12 regulation. PMID: 26672987
Immunohistochemical expression of COX-1 and VEGF is associated with poor prognostic parameters in renal cell carcinoma. PMID: 26339385
over-expression of COX-1 in an aberrant manner intersects multiple pro-tumorigenic pathways in high-grade serous ovarian cancer PMID: 25972361
COX-2 displays an enhanced facilitatory control on tachykininergic contractile activity in diverticular disease PMID: 24758697
Significant associations with NSAID-exacerbated respiratory disease were identified for: ALOX15 homozygous genotype and PTGS-1 rs5789 A/A homozygous genotype PMID: 26067486
Origin of the Enigmatic Stepwise Tight-Binding Inhibition of Cyclooxygenase-1. PMID: 26562384
cadmium at the highest tested concentrations modulates COX-1 and COX-2 at mRNA level in THP-1 macrophages PMID: 25645360
Aspirin Half Maximal Inhibitory Concentration Value on Platelet Cyclooxygenase1 in Severe Type-2 Diabetes Mellitus is not Significantly Different from that of Healthy Individuals. PMID: 23677911
Quantitative real-time PCR measurements of mRNA levels of genes PTGS1 and PTGS2 revealed no effect of the tested vanadium compound on the levels of analyzed transcripts. PMID: 25398544
Data suggest that, in organization of enzymes in post-translational endoplasmic reticulum, mPGES1 (microsomal prostaglandin E synthase-1) is likely co-localized with COX2 within a distance of 14.4 A; mPGES-1 is localized much farther from COX1. PMID: 25988363
Single nucleotide polymorphisms of RANK and PTGS1 show genetic associations with osteoproliferative changes in ankylosing spondylitis. PMID: 24651623
Studied the impact of blood type, functional polymorphism (T-1676C) of the COX-1 gene promoter, and clinical factors on the development of peptic ulcer during cardiovascular prophylaxis with low-dose aspirin. PMID: 25243161
Baseline omega-3 fatty acid levels do not influence TxA(2) generation in patients with or at high risk for CVD in the absence of COX-1 activity. PMID: 24370448
Data indicate that Protectin DX inhibited both cyclooxygenase-1 and -2 (COX-1 and COX-2) in neutrophils. PMID: 24254970
A report of allele frequencies on COX-1 polymorphisms in pediatric patients with cardiovascular anomalies. PMID: 24535852
Impacts of COX-1 gene polymorphisms on vascular outcomes in patients with ischemic stroke and treated with aspirin PMID: 24930730
The association of four common polymorphisms from four candidate genes (COX-1, COX-2, ITGA2B, ITGA2) with aspirin insensitivity PMID: 24244288
heterozygosity correlates with recurrent postoperative bleeding PMID: 24008976
There was no association between COX-1 C50T and COX-2 G765C polymorphisms and AR in Chinese stroke patients. In addition, COX-1 C50T and COX-2 G765C polymorphisms had no effect on the platelet response to aspirin PMID: 22972377
COX1 promoter polymorphisms (T-1676C and A-842G/ C50T) may not be associated with the risk of developing ulcerative colitis in a Japanese population. PMID: 18705313
as COX-1 and COX-2 express and affect VEGF synthesis in HNSCC cells, we should check COX-1 expression in investigations on cancer treatment by inhibiting COX-2-induced prostaglandins. PMID: 21301321
COX1 A-842G and C50T polymorphisms that contribute to resistance or augmented response to aspirin are rare in the Chinese population. PMID: 17559347
SNPs in COX1 -842A>G determined thrombotic complications in myocardial infarction. PMID: 22940005
COX-1 expression is widely detected in the hippocampus but decreases sharply in Niemann-Pick type C (NPC) knock-out mice compared to NPC+/+ mice. PMID: 23660496
the present study did not confirm correlations between tissue mRNA levels and protein content of COX-1 and EGFR. PMID: 24171795
rs2071746 in HO-1 gene, rs1330344 in COX-1 gene contribute to resistance to aspirin. PMID: 22609818
In PTGS1, a functional polymorphism was associated with increased rectal cancer risk. PMID: 24022467
Thromboxane A(2) generation, in the absence of platelet COX-1 activity, in patients with and without atherothrombotic myocardial infarction PMID: 23985963
COX1 inhibition by aspirin is suboptimal in 15% of patients with systemic lupus erythematosus. The suboptimal response was associated with metabolic syndrome, obesity, and higher CRP concentrations. PMID: 24022862
Overexpression of cyclooxygenase-1 correlates with renal cell carcinoma. PMID: 23886173